NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0207658_10074609

Scaffold Ga0207658_10074609


Overview

Basic Information
Taxon OID3300025986 Open in IMG/M
Scaffold IDGa0207658_10074609 Open in IMG/M
Source Dataset NameSwitchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)2578
Total Scaffold Genes5 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)4 (80.00%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)2 (100.00%)
Associated Families2

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere → Corn, Switchgrass And Miscanthus Rhizosphere Microbial Communities From Kellogg Biological Station, Michigan, Usa

Source Dataset Sampling Location
Location NameUSA: Michigan, Kellogg Biological Station
CoordinatesLat. (o)42.3948Long. (o)-85.3738Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F010060Metagenome / Metatranscriptome309Y
F040267Metagenome / Metatranscriptome162Y

Sequences

Protein IDFamilyRBSSequence
Ga0207658_100746093F010060GGAGGMETVLFTDQDIVVFVITATTLALVFSVLGLATPRRTRSDIQHQLNGMR
Ga0207658_100746094F040267GAGMGTKPILFWSKPRSDIERHLDREADDFLVVDTNSADELQKLYKLRRETPIFDPFPQYGEHYRDFIDHVVASDCRYHIVGLEACQELLRALEDPSLVHSSIEELLAGIKLVGSAYTDSSARAFSRPSTIKRSKKTSIDWSYLNWANSSVLAILVFVATVAGNILSPNNSLIAAVVATSLFAALYICVRANFSEIFSSNVATHGLMASWARG

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.