NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0207651_10321179

Scaffold Ga0207651_10321179


Overview

Basic Information
Taxon OID3300025960 Open in IMG/M
Scaffold IDGa0207651_10321179 Open in IMG/M
Source Dataset NameMiscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)1294
Total Scaffold Genes4 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)3 (75.00%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (50.00%)
Associated Families2

Taxonomy
All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere → Corn, Switchgrass And Miscanthus Rhizosphere Microbial Communities From Kellogg Biological Station, Michigan, Usa

Source Dataset Sampling Location
Location NameUSA: Michigan, Kellogg Biological Station
CoordinatesLat. (o)42.3948Long. (o)-85.3738Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F000805Metagenome / Metatranscriptome883Y
F019580Metagenome / Metatranscriptome229Y

Sequences

Protein IDFamilyRBSSequence
Ga0207651_103211791F000805N/ASMGMPSGDSPAKAQAYYHYLQAHQLSMQRPATWEVRWVDLAWLWGFVIVLSFVLIMWVWQYRSTRQKANIYPVDSFGGYTTELAGPATVFFLVLTGIVVAFAVVLVFGHLVWGQKF
Ga0207651_103211794F019580AGGVYLKHVTSLQFLTYLSFFAVLLAAMFRCVPGRAPQTRDEPYSDEELYAHDRKAAKYFLAGGFFLVLGSLHMVLKNLPWVSEYLARTGYAGHLVRDLSNTHVMIVGGGTLLATGLCWLALPRVVGRPLASEGLAQCAFW
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.