NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0207651_10056430

Scaffold Ga0207651_10056430


Overview

Basic Information
Taxon OID3300025960 Open in IMG/M
Scaffold IDGa0207651_10056430 Open in IMG/M
Source Dataset NameMiscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)2703
Total Scaffold Genes5 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)4 (80.00%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)2 (66.67%)
Associated Families3

Taxonomy
All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere → Corn, Switchgrass And Miscanthus Rhizosphere Microbial Communities From Kellogg Biological Station, Michigan, Usa

Source Dataset Sampling Location
Location NameUSA: Michigan, Kellogg Biological Station
CoordinatesLat. (o)42.3948Long. (o)-85.3738Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F000428Metagenome / Metatranscriptome1150Y
F001440Metagenome / Metatranscriptome694Y
F026147Metagenome / Metatranscriptome199Y

Sequences

Protein IDFamilyRBSSequence
Ga0207651_100564301F000428N/AATHMRLDDHFGSGSTLQRNERVKLAASFWNNVGAGMVIVGMAGAFFLDKPPGAWAKIGIAIGGLVLGWLCYSIASNILTYMQKILHSK
Ga0207651_100564304F001440GGGGGMPNVKSMGWAIYAVGCAIWLFGYLSTGHAPAFDWAVATPWWISTFVPNREAELGLALMFASMIPIYWRAGQERVH
Ga0207651_100564305F026147AGGCGGMTFGNPSTGTLAKLSPQLLTTRGRPIKFTSERLQQIRNLVERGESREGIADLLDVTIGSLQVTCSRLGISLRRPKVDNGARFRRQLNSISRKKTITMHDPIDHNGSALSQPIEEQSQENSRSGPAEPALAAKPQQERVKTLEAASASIAIRIQYKGTERITELPLTLDEIARLAWEAEFRDMRIGQFIGELIAAMVTKDLFRVVLDKP
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.