NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0207651_10007127

Scaffold Ga0207651_10007127


Overview

Basic Information
Taxon OID3300025960 Open in IMG/M
Scaffold IDGa0207651_10007127 Open in IMG/M
Source Dataset NameMiscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)5937
Total Scaffold Genes15 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)14 (93.33%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)2 (100.00%)
Associated Families2

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere → Corn, Switchgrass And Miscanthus Rhizosphere Microbial Communities From Kellogg Biological Station, Michigan, Usa

Source Dataset Sampling Location
Location NameUSA: Michigan, Kellogg Biological Station
CoordinatesLat. (o)42.3948Long. (o)-85.3738Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F039688Metagenome163Y
F051995Metagenome / Metatranscriptome143N

Sequences

Protein IDFamilyRBSSequence
Ga0207651_1000712715F039688GAGGMNRYVIMAKENYPGATIKEICRCNSNPGDIRNALADYTVTGSQGTRIYKYNHVEILKVSGIKRKEASAQMKKPIRNVDDFSGKPSANQIASVLEQIDAMRAANGEQAAQGPAAQARPPLPQRKLEAKP
Ga0207651_100071274F051995GGGGGMTDYDPERIDMRIESRQGKLAANAEAIERWQRKLFRAANELQKLVAQRKRLLNPARGKLVYKGENLTGMGGGAVDGMNDDIPL

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.