NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0207661_10000883

Scaffold Ga0207661_10000883


Overview

Basic Information
Taxon OID3300025944 Open in IMG/M
Scaffold IDGa0207661_10000883 Open in IMG/M
Source Dataset NameCorn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)19704
Total Scaffold Genes27 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)24 (88.89%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)2 (100.00%)
Associated Families2

Taxonomy
All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria(Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere → Corn, Switchgrass And Miscanthus Rhizosphere Microbial Communities From Kellogg Biological Station, Michigan, Usa

Source Dataset Sampling Location
Location NameUSA: Michigan, Kellogg Biological Station
CoordinatesLat. (o)42.3948Long. (o)-85.3738Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F009274Metagenome / Metatranscriptome320Y
F084486Metagenome / Metatranscriptome112Y

Sequences

Protein IDFamilyRBSSequence
Ga0207661_1000088313F009274AGGMPVWIARRAVPAVWKRVPWRMVWAVIVWLGAKGRERVEHNLTQKEQREFWRLVKKSKGRPGNLLQRDRTRLKNIAGKAVRG
Ga0207661_100008839F084486GAGMTDGPSGLSSKALRAEQARIGRFLESMAKHRKALELAIEEGFGGTLDPAEWRKTFESAEPHDANRTMVVTGDHSAVLNAYVEILKTSAGSRLVGLLPYRRPHAGQTFEVLVEDGCLTADQAAELNIAYAIEGRLEHASPDVDASEVLEAIERLRRALPGLIEAVLAWLERHGVRFDEQR
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.