NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0207653_10000627

Scaffold Ga0207653_10000627


Overview

Basic Information
Taxon OID3300025885 Open in IMG/M
Scaffold IDGa0207653_10000627 Open in IMG/M
Source Dataset NameCorn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)12208
Total Scaffold Genes16 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)12 (75.00%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)3 (100.00%)
Associated Families3

Taxonomy
All Organisms → cellular organisms → Bacteria(Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere → Corn, Switchgrass And Miscanthus Rhizosphere Microbial Communities From Kellogg Biological Station, Michigan, Usa

Source Dataset Sampling Location
Location NameUSA: Michigan: Kellogg Biological Station
CoordinatesLat. (o)42.3948Long. (o)-85.3738Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F043033Metagenome / Metatranscriptome157Y
F057238Metagenome / Metatranscriptome136N
F101117Metagenome / Metatranscriptome102N

Sequences

Protein IDFamilyRBSSequence
Ga0207653_1000062715F043033AGGVVVPLQAAADRASIYDLLPFITIAALGAGFLVVFRQRAAARRMARQQRPMHAAITGSRGRETSLPGRPWWGNPWLWAAVCAVSLVLGFFVWPGLFGGAFIVLPFVWIRRPRREPRMDPRTNGHTSRDAGTFTGE
Ga0207653_100006276F057238GGAGGVEQTVSPTPNEGITMTTYERWRDVAGYRPGRHDNSGLRARLSGTKIEDRPIVSELRLAMEEREALTLPRKASTRR
Ga0207653_100006277F101117GGAMSMFNTNEPRTPGGRMGDDMEKMFLDEAKKDHLANEAKRADAEEDRERAELGESVTPKRPWWKFWA

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.