| Basic Information | |
|---|---|
| Taxon OID | 3300025883 Open in IMG/M |
| Scaffold ID | Ga0209456_10170369 Open in IMG/M |
| Source Dataset Name | Pelagic marine sediment microbial communities from the LTER site Helgoland, North Sea, for post-phytoplankton bloom and carbon turnover studies - COGITO 998_met_11 (SPAdes) |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 937 |
| Total Scaffold Genes | 2 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 1 (50.00%) |
| Novel Protein Genes | 2 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (50.00%) |
| Associated Families | 2 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium | (Source: UniRef50) |
| Source Dataset Ecosystem |
|---|
| Environmental → Aquatic → Marine → Neritic Zone → Unclassified → Pelagic Marine → Pelagic Marine Microbial Communities From North Sea |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Helgoland, North Sea, Atlantic Ocean | |||||||
| Coordinates | Lat. (o) | 53.9944 | Long. (o) | 6.8905 | Alt. (m) | Depth (m) | 29 | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F009527 | Metagenome / Metatranscriptome | 316 | Y |
| F054789 | Metagenome / Metatranscriptome | 139 | N |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0209456_101703691 | F009527 | N/A | RGGKTSLAYAFIDYVIKYTKRPVILDSFPQKVIDEGIPDHWIDRVSNTSFNDIAEVDEPAVWLLDDSATHFNSRSAMSSTNQTLAKAAGVLSHFGGGMTVIFTTQSLSGIDLSLLRYTTISPVVRWVDKDLIAQERKEWRGEVEHGQYELRRVCKDSRLRDFFWSSKDSCLVKAPYPGFLKKENDPIKADLLSRPMRYHSIEDKKIMLGIIKPPAKQRAKRKKVVIDE |
| Ga0209456_101703692 | F054789 | AGAAGG | MNREQQRKFDRIAASRLSRIKGGIPRHIALSNSRSITLRNKLNRLGLQGPHIEAALSMVDEMGLQEVMSKQPLGSRFASMPQAKK |
| ⦗Top⦘ |
 |
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |