NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0209223_10084889

Scaffold Ga0209223_10084889


Overview

Basic Information
Taxon OID3300025876 Open in IMG/M
Scaffold IDGa0209223_10084889 Open in IMG/M
Source Dataset NamePelagic Microbial community sample from North Sea - COGITO 998_met_06 (SPAdes)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)1781
Total Scaffold Genes3 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)1 (33.33%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (50.00%)
Associated Families2

Taxonomy
All Organisms → Viruses → Predicted Viral(Source: DeepVirFinder)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Neritic Zone → Unclassified → Pelagic Marine → Pelagic Marine Microbial Communities From North Sea

Source Dataset Sampling Location
Location NameHelgoland, sampling site Kabeltonne
CoordinatesLat. (o)54.184167Long. (o)7.9Alt. (m)Depth (m)1
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F031400Metagenome / Metatranscriptome182Y
F039135Metagenome164Y

Sequences

Protein IDFamilyRBSSequence
Ga0209223_100848891F039135N/AMKYLKKYKQHKESVVVDLKFQNVEELLESLSLWHDALLNSISAEEVDIYDTFKLPNDDFADKLDLDTLSDNVEFINSLSSIALKKSELKNSEDFQTFLNKPCKFMFIFDINTNELENPIYLLFQVWNETIKKWEDVKLYKINDDVKKFYDKLTSKVIEIIDGDENYIYETSNGNEWILQNADAETDVYKKTFRREELQDLLSDRN
Ga0209223_100848893F031400GGAMKWLRNYELFKESKTYSNKNLLSEMCISMVLLNNEFLDNILDRGLKARYSDNSQIFLTDLKNLLLAKNRLKLGKFVDNKCVVDDEISKVNGMFSDVTFDIEKDWKILVNSRIAARNIIDKLIPDEKLESDRIRNIFWIGPNKDGDYQEDIVIELTDGRQYSFFLNKNLTSSKTSSFNLFAEELIGSDLDRLFKADYLPRWDKLTQEWVRVIYENANKNIQLHIEKFIDPKRIDSMG
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.