NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0209483_1026834

Scaffold Ga0209483_1026834


Overview

Basic Information
Taxon OID3300025862 Open in IMG/M
Scaffold IDGa0209483_1026834 Open in IMG/M
Source Dataset NameArctic peat soil microbial communities from the Barrow Environmental Observatory site, Barrow, Alaska, USA - NGEE PermafrostL2-A (SPAdes)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)2892
Total Scaffold Genes4 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)3 (75.00%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)2 (66.67%)
Associated Families3

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil → Arctic Peat Soil Microbial Communities From The Barrow Environmental Observatory Site, Barrow, Alaska, Usa

Source Dataset Sampling Location
Location NameUSA: Barrow Environmental Observatory site, Alaska
CoordinatesLat. (o)71.299Long. (o)-156.61Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F001528Metagenome / Metatranscriptome677Y
F004392Metagenome / Metatranscriptome440N
F050789Metagenome / Metatranscriptome145N

Sequences

Protein IDFamilyRBSSequence
Ga0209483_10268342F001528AGGAGMSEKNQIVVVLIVALFLGAFVDRTTALKIVAGVVLLWTLQNQPVVFECIRRLFSFVQRRPSVREYRGGVTTVRAS
Ga0209483_10268343F004392AGGAMPVNGPETISDLKTPQPVAPEGRSVRAAKDAKPAVGRGAATRRRRDRQESSQTNGEERFFLASANRNGDVPTLGRECATEAEAIIEAFREKVNLYKVTEFQTRADIGRSGEPILRKETLKKNNPAS
Ga0209483_10268344F050789N/ASMSVLLRHAGLSEGTVGILPLILFAAGILLKPRAVQFIERRRKDRTTGTHDGRAHMDAGEKQDIARKETVERCQ
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.