NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0209199_1043714

Scaffold Ga0209199_1043714


Overview

Basic Information
Taxon OID3300025809 Open in IMG/M
Scaffold IDGa0209199_1043714 Open in IMG/M
Source Dataset NamePelagic marine microbial communities from North Sea - COGITO_mtgs_110523 (SPAdes)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)2305
Total Scaffold Genes5 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)3 (60.00%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (33.33%)
Associated Families3

Taxonomy
All Organisms → Viruses → unclassified viruses → Circular genetic element sp.(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Pelagic → Unclassified → Pelagic Marine → Pelagic Marine Microbial Communities From North Sea

Source Dataset Sampling Location
Location NameGermany:Helgoland, sampling site Kabeltonne, North Sea
CoordinatesLat. (o)54.1883Long. (o)7.9Alt. (m)Depth (m)1
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F001611Metagenome / Metatranscriptome663N
F002374Metagenome / Metatranscriptome566Y
F020017Metagenome / Metatranscriptome226Y

Sequences

Protein IDFamilyRBSSequence
Ga0209199_10437141F020017N/AQSAVPVSVYGNRPQETSTMTGTTGMVTQAGFGALAPFLTGVGRLLGSKTGQIATGVGTAVGLGSTQFMGMNGREKPVLTQSRRNKAKVRQLVNFMGIEGTANFLSQSIGQNVSPNDVVALLLRTFRNDGAYITKAQVRNLRRTTNRFKSLEKQVKEATSMSRTTRRAPVRRASSTTLIKN
Ga0209199_10437142F001611AGGAGMPLVQKTLTLAAGATSDNILANTNYEFVDGNVRLRVASAVDTAGTSATADTFLNVSVNNAEYSKDVSVPALVTGQPFGVLNGSYTNNDLLTTGSQRNRVLVRFTNDTGTTRTIRCGIFIG
Ga0209199_10437144F002374N/AMNQVLLYASIILASVSFFLCAYACVRVGKLLNSVKGLEWDTVATLTGDIGTIKKSIQTLNNRINGLNSPKLNDELLHYAIKQQNGAMHPPTDKLGG
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.