NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0208784_1008380

Scaffold Ga0208784_1008380


Overview

Basic Information
Taxon OID3300025732 Open in IMG/M
Scaffold IDGa0208784_1008380 Open in IMG/M
Source Dataset NameAqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_N_>0.8_DNA (SPAdes)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)3574
Total Scaffold Genes7 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)6 (85.71%)
Novel Protein Genes5 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)4 (80.00%)
Associated Families5

Taxonomy
All Organisms → cellular organisms → Archaea → Euryarchaeota → unclassified Euryarchaeota → Euryarchaeota archaeon(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous → Aqueous Microbial Communities From The Delaware River/Bay And Chesapeake Bay Under Freshwater To Marine Salinity Gradient To Study Organic Matter Cycling In A Time-Series

Source Dataset Sampling Location
Location NameUSA: Delaware Bay
CoordinatesLat. (o)39.283Long. (o)-75.3633Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F000311Metagenome / Metatranscriptome1326Y
F000450Metagenome / Metatranscriptome1126Y
F000980Metagenome / Metatranscriptome814Y
F007470Metagenome / Metatranscriptome350Y
F031384Metagenome / Metatranscriptome182Y

Sequences

Protein IDFamilyRBSSequence
Ga0208784_10083801F031384AGGAMPNWCFNGLTIEGNPDSVKKLINQMNKPFKQLHDTWNMETGQMEKKHTLYPNPIFAFHNIYNYMDAGVSEE
Ga0208784_10083802F000450AGGAMGDRANFVFVQPSGETIVLYGHWAGSGMLETLAEAVAKAQTRWTDPSYATRIAISQMIGDSWGMETGWGLQVNEISDNEHKIPVVNWLECTFSLHEEDSHFNQGNKVRGMKNEAIFTMDLREFVEKYSDAKILV
Ga0208784_10083804F007470AGGAGMDYQDGFQDGVKFAREVIINNIRLWAESSDDGQVYDDIADKIEFGEVDYEL
Ga0208784_10083805F000311GAGGMYFELTAPDRLSMEMAYWDAQIMGLDPQAMTPLTFNIGTGSIEKVSRIRDKFNLVESYVSDYEPTGYIRS
Ga0208784_10083806F000980N/AMTSYQKYTWVCTGDCDALIEYTIKDGYGWPAGVMDLTCRCGSNCTLLSVEDATIPYTETKGNEMETTELLVPESYNSNLLVTYKKINGYSNPEYITEKVVDLEWELRNGREASKRNGIYQSKIDTVKDIISEAYADSDDQETLQAIAEALGIELTRDVEFTATVEVRGTFTLNLLEDYDLETEITDALYVDANNGNIVIDDTEVCNVREAY
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.