NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0209606_1116484

Scaffold Ga0209606_1116484


Overview

Basic Information
Taxon OID3300025730 Open in IMG/M
Scaffold IDGa0209606_1116484 Open in IMG/M
Source Dataset NameActive sludge microbial communities of municipal wastewater-treating anaerobic digesters from USA - AD_UKC057_MetaG (SPAdes)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)980
Total Scaffold Genes4 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)3 (75.00%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)2 (66.67%)
Associated Families3

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Engineered → Wastewater → Anaerobic Digestor → Unclassified → Unclassified → Anaerobic Digestor Sludge → Active Sludge Microbial Communities Of Municipal Wastewater-Treating Anaerobic Digesters From Various Locations

Source Dataset Sampling Location
Location NameUSA
CoordinatesLat. (o)41.53Long. (o)-90.43Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F005744Metagenome / Metatranscriptome391Y
F034940Metagenome / Metatranscriptome173Y
F101100Metagenome / Metatranscriptome102N

Sequences

Protein IDFamilyRBSSequence
Ga0209606_11164841F034940GAGGMGNDCWYYRAQYAGMTKVCMRQSIVECGRIRRFGLCPKPPDSEAWRRCGFAIGQVETAQAVR
Ga0209606_11164843F005744AGGAGMDETFEIIKAGAPDAPPEQALYRIQHTYSDGSGGRLNIDWDGLLRLHELIHDRIALEGYVCETCDTKGCHRPATWEIECRGAGVSGRLIYSCDEHCPDEAILSPMDGMRRLVESRKEE
Ga0209606_11164844F101100N/ADEEIIRGGWYLLADSLAAAREVYPAHLFPSMTFIEVGKGLCVECNRRAVDALVEE

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.