NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0208197_1010490

Scaffold Ga0208197_1010490


Overview

Basic Information
Taxon OID3300025720 Open in IMG/M
Scaffold IDGa0208197_1010490 Open in IMG/M
Source Dataset NameActive sludge microbial communities of municipal wastewater-treating anaerobic digesters from Japan - AD_JPNNA4_MetaG (SPAdes)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)5293
Total Scaffold Genes10 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)9 (90.00%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)3 (100.00%)
Associated Families3

Taxonomy
All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Microbacteriaceae → Leucobacter → unclassified Leucobacter → Leucobacter sp.(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Engineered → Wastewater → Anaerobic Digestor → Unclassified → Unclassified → Anaerobic Digestor Sludge → Active Sludge Microbial Communities Of Municipal Wastewater-Treating Anaerobic Digesters From Various Locations

Source Dataset Sampling Location
Location NameJapan
CoordinatesLat. (o)37.43Long. (o)138.83Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F020914Metagenome / Metatranscriptome221N
F067770Metagenome / Metatranscriptome125N
F078767Metagenome / Metatranscriptome116N

Sequences

Protein IDFamilyRBSSequence
Ga0208197_10104903F078767AGAAGGMTNQITGITDEILTALQKAGCRTVGILPEVLMFSGNNNPFGFIMLNSETTENDNGGILTQLLDISIFIITQNGINKTKEHCNVLYAAIGEILNSSGLNSKTALVNLETINWHADMPFVTQLVGDLDIISSINFNIKYMNAR
Ga0208197_10104904F067770GAGMIEFRYNSPVFKLGKISRSEWRELGMSARSEIVKRTRSGIDINHQPFHEYSAATQEYKSGIMQTRGLGSSVVTLQDTGQMHRSLSIEVQANAAILYYADQNRARVALLHQTGGYHLPKREHFGFNKTDGNKYLEKIAKLQTIKNKKANR
Ga0208197_10104906F020914AGAAGGMAIYEKYGFAIDQILSENQALPNATSGDSTNTIELDAVADDGLHIVVCAASTTVELASGASLEIRPTIGATEGTVTTVLPSILIKEGVQSDVSWAPGEMICQFNIPAKLIGSAKYLKLTYVTSANESDDKVEAFSVRR

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.