NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0208458_1000531

Scaffold Ga0208458_1000531


Overview

Basic Information
Taxon OID3300025714 Open in IMG/M
Scaffold IDGa0208458_1000531 Open in IMG/M
Source Dataset NameActive sludge microbial communities of municipal wastewater-treating anaerobic digesters from USA - AD_UKC085_MetaG (SPAdes)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)39370
Total Scaffold Genes35 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)28 (80.00%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)2 (100.00%)
Associated Families1

Taxonomy
All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Syntrophobacterales → Syntrophaceae → Smithella → unclassified Smithella → Smithella sp. SCADC(Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem
Engineered → Wastewater → Anaerobic Digestor → Unclassified → Unclassified → Anaerobic Digestor Sludge → Active Sludge Microbial Communities Of Municipal Wastewater-Treating Anaerobic Digesters From Various Locations

Source Dataset Sampling Location
Location NameUSA
CoordinatesLat. (o)39.88Long. (o)-75.22Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F010068Metagenome / Metatranscriptome309Y

Sequences

Protein IDFamilyRBSSequence
Ga0208458_100053122F010068GGAGGMNVKGNFFVSARTTMIEVFGKDRWNTFMTKLVEKDKYFNSVIMSVTLVPVEKLIVFFDEMCGEFFDNDKMQYQTFGRSGAKAALSPGGVYHSYLLSKDIKQFVEFALPKLWTTYYDGGTFEAWFENNTVHIKITGIPVKYIYFEYLVMGYFQQALKVFGKRSVAKKVRSLSSGDEDLYFQFQLKDS
Ga0208458_100053125F010068GGAGGMHIKGIFFVTTKTVIVQSFGEERWNAFMTKLAEKDNFFSKMIMAISLVPVEKLIIFFDEMCKEFFNNDKMAYEIFGRSGAKHVLHEGGMYHSYLLNKDMKNFVEFALPKLWSTYFDGGTITTKYENNIVHIKITGVNVKYIYFEHLLMGYFQQALKVFGKKSVAKKVRGIVQGDNDIYFQFELKDS

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.