| Basic Information | |
|---|---|
| Taxon OID | 3300025696 Open in IMG/M |
| Scaffold ID | Ga0209532_1047195 Open in IMG/M |
| Source Dataset Name | Pelagic Microbial community sample from North Sea - COGITO 998_met_02 (SPAdes) |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 1760 |
| Total Scaffold Genes | 3 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 3 (100.00%) |
| Novel Protein Genes | 2 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 2 (100.00%) |
| Associated Families | 2 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Saprospiria → Saprospirales → unclassified Saprospirales → Saprospirales bacterium | (Source: UniRef50) |
| Source Dataset Ecosystem |
|---|
| Environmental → Aquatic → Marine → Neritic Zone → Unclassified → Pelagic Marine → Pelagic Marine Microbial Communities From North Sea |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Helgoland, sampling site Kabeltonne | |||||||
| Coordinates | Lat. (o) | 54.184167 | Long. (o) | 7.9 | Alt. (m) | Depth (m) | 1 | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F000325 | Metagenome / Metatranscriptome | 1296 | Y |
| F019643 | Metagenome / Metatranscriptome | 228 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0209532_10471951 | F019643 | AGGA | MAKYYIKTGTLELIFSTDKEPYDACRRVIHELNANDEYDEYMYLDERGYRDYTSADTTTFVIDTEQILRKEGYIK |
| Ga0209532_10471953 | F000325 | AGGAG | MKTAKGNDKLGKENCIVVSRPVGDTCPPSCEFLGNGCYAEQLEKIYPGVRPAGMQNLITEKNKIRAMLINAEKKDKDLRWHERGDFYKNGSELDIEYIDNILWACRSILAEGGKLPKMWAYTHIYDPKLSRILGKYITMYASVHNHDDVAKAKAAGFELFAWCDSDEKIAPKRPRGKKKADQWRSDLPKLVVLGDDRYITCPEIRRGRGVVTCTKSKNSVNCQLCVQGLANVLFPSH |
| ⦗Top⦘ |
 |
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |