NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0209652_1001411

Scaffold Ga0209652_1001411


Overview

Basic Information
Taxon OID3300025684 Open in IMG/M
Scaffold IDGa0209652_1001411 Open in IMG/M
Source Dataset NameMarine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - ESP_74LU_5_DNA (SPAdes)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)19584
Total Scaffold Genes28 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)21 (75.00%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)2 (66.67%)
Associated Families3

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Intertidal Zone → Unclassified → Marine → Marine Microbial Communities From Expanding Oxygen Minimum Zones In The Northeastern Subarctic Pacific Ocean

Source Dataset Sampling Location
Location NameSaanich Inlet, British Columbia, Canada
CoordinatesLat. (o)48.6Long. (o)-123.5Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F015169Metagenome / Metatranscriptome257Y
F048178Metagenome / Metatranscriptome148N
F063653Metagenome / Metatranscriptome129N

Sequences

Protein IDFamilyRBSSequence
Ga0209652_100141111F063653AGAAGMLTIPDICDKLKRLDEVAILELLEVNSEEIVSRFQDRIEDMADYLEEVLDDN
Ga0209652_100141122F048178N/AMKHSVGKVIPAATLTEVFTVPAGYKAEVSTLFASNHQGNNKTITLYWQHAHDITHKIYIVFGYVIHSNNYLQFSDSMVMQSGDSIQVLTEAGSEMSVIASFDLYKENTVPFMAD
Ga0209652_10014119F015169GGAGMEDKQYYHFKKKCSRPNVETSSELFYVCSEDARWDDVMRQFAAFLDSCGYVGVYEKVDIMLDEYWDSGFAYGGTAE
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.