Basic Information | |
---|---|
Taxon OID | 3300025673 Open in IMG/M |
Scaffold ID | Ga0209494_1087203 Open in IMG/M |
Source Dataset Name | Methane-oxidizing microbial communities from mesocosms in the Hudson Canyon - EN1B Hudson Canyon (SPAdes) |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | DOE Joint Genome Institute (JGI) |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 969 |
Total Scaffold Genes | 2 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 2 (100.00%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
All Organisms → cellular organisms → Bacteria → Proteobacteria | (Source: UniRef50) |
Source Dataset Ecosystem |
---|
Environmental → Aquatic → Marine → Unclassified → Unclassified → Methane Seep Mesocosm → Methane-Oxidizing Microbial Communities From Mesocosms In The Gulf Of Mexico And Hudson Canyon, Usa |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | Hudson Canyon | |||||||
Coordinates | Lat. (o) | 39.55 | Long. (o) | -72.4 | Alt. (m) | Depth (m) | Location on Map | |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F016531 | Metagenome / Metatranscriptome | 246 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0209494_10872031 | F016531 | AGG | MNRFSWTLLIGMLLMLSGISGVSRLSQAAISSGFDGSVVSNVNAPDRLLVLGFIGSRVASELIHRGESTVIIKDEDRSLANDKINDRKPGDVVN |
⦗Top⦘ |