NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0209556_1023089

Scaffold Ga0209556_1023089


Overview

Basic Information
Taxon OID3300025547 Open in IMG/M
Scaffold IDGa0209556_1023089 Open in IMG/M
Source Dataset NameMarine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - SI037_S3LV_150m_DNA (SPAdes)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)1832
Total Scaffold Genes5 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)2 (40.00%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)2 (100.00%)
Associated Families2

Taxonomy
All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Intertidal Zone → Unclassified → Marine → Marine Microbial Communities From Expanding Oxygen Minimum Zones In The Northeastern Subarctic Pacific Ocean

Source Dataset Sampling Location
Location NameSaanich Inlet, British Columbia, Canada
CoordinatesLat. (o)48.6Long. (o)-123.5Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F002566Metagenome / Metatranscriptome547Y
F093713Metagenome106N

Sequences

Protein IDFamilyRBSSequence
Ga0209556_10230892F093713GGAGGVNDILTRAGKTWLQTFVGLLVASWASRTINIETLDPLQELSTIAGFAFASIPAAVSVLQNSLKLANPNA
Ga0209556_10230894F002566AGGAGVIYLKWKLSTEGVSGTGPEETIADRGGLAEASWAVDADGYRIGYLTQTANLDDLDAWDVTEPTEAQALTFCQVLYAEAEVLPDGRISGPPPPDDDPE

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.