| Basic Information | |
|---|---|
| Taxon OID | 3300025543 Open in IMG/M |
| Scaffold ID | Ga0208303_1000490 Open in IMG/M |
| Source Dataset Name | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_2 Viral MetaG (SPAdes) |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 16274 |
| Total Scaffold Genes | 29 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 6 (20.69%) |
| Novel Protein Genes | 2 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (50.00%) |
| Associated Families | 2 |
| Taxonomy | |
|---|---|
| Not Available | (Source: ) |
| Source Dataset Ecosystem |
|---|
| Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous → Aqueous Microbial Communities From The Delaware River/Bay And Chesapeake Bay Under Freshwater To Marine Salinity Gradient To Study Organic Matter Cycling In A Time-Series |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | USA: Chesapeake Bay | |||||||
| Coordinates | Lat. (o) | 37.1 | Long. (o) | -76.0972 | Alt. (m) | Depth (m) | Location on Map | |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F004358 | Metagenome / Metatranscriptome | 442 | Y |
| F054414 | Metagenome / Metatranscriptome | 140 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0208303_100049024 | F054414 | N/A | MTFNDLYNQLLEDFTAPTDTKRPAKVRPSGKYGTINPQMNEPHSTKAISGFKGQPGGKMKTMFVTLPVRKKKKKVKTDS |
| Ga0208303_10004905 | F004358 | GAGG | MFGLITMLLSTLGATGMGSMLKIIGGIAQSRSLANEARAKRELIRDMSLQKSNAEFQQAVFGEADKDAGMFTRGTRRIIALIGMLNFAVISILCTLWPTVELVTFTPPENKENFSLLWGLAVFPSSDPITTAITTGHISLVSVATLGCIIGFYFTPGGK |
| ⦗Top⦘ |
 |
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |