NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0208903_1009495

Scaffold Ga0208903_1009495


Overview

Basic Information
Taxon OID3300025502 Open in IMG/M
Scaffold IDGa0208903_1009495 Open in IMG/M
Source Dataset NameSaline lake microbial communities from Ace Lake, Antarctica - Antarctic Ace Lake Metagenome 02UKJ (SPAdes)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)3534
Total Scaffold Genes5 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)3 (60.00%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)2 (100.00%)
Associated Families2

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Saline Lake → Saline Lake Microbial Communities From Various Lakes In Antarctica

Source Dataset Sampling Location
Location NameAce Lake, Antarctica
CoordinatesLat. (o)-68.4725Long. (o)78.188Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F010646Metagenome / Metatranscriptome301N
F039337Metagenome164N

Sequences

Protein IDFamilyRBSSequence
Ga0208903_10094952F039337AGGAGMSLLVHYHTMSKYNEDTFKTEERNQADVLGWMLMGTGISEITEKTIPELLFRVRFMDFSYGKPYFNDDPSNEQITTLFKAHMGLTIEITNRGIRNLNTRRRFMVNQLDNMERRIERKIAKTQ
Ga0208903_10094954F010646GGAMLCLLIHKALKGQISYLHYPILTYKRYNLTINKRNTMKPIRSNELDFFNKIIENKFKHKRQAVETEITIEAQKLADKQAPTMAKQCGVESDLKALKIACDKYKTFIESKNATEDKLFSDVRDQMKQVSSKLERIGMARAWDQVFDGYDCREDGAEYFVQKLNNCCYDEAYKSVKANHKVYNIIKDKKSECEIVLHTGSDINSTISTLQKVMKTVDIDLPVPSHLLQLAIK
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.