NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0208105_1005158

Scaffold Ga0208105_1005158


Overview

Basic Information
Taxon OID3300025487 Open in IMG/M
Scaffold IDGa0208105_1005158 Open in IMG/M
Source Dataset NameFreshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE16Jul07 (SPAdes)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Bioenergy Institute (JBEI), DOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)3041
Total Scaffold Genes8 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)4 (50.00%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)2 (66.67%)
Associated Families3

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater → Freshwater Microbial Communities From Crystal Bog Lake, Wisconsin, Usa

Source Dataset Sampling Location
Location NameCrystal Bog, Wisconsin, USA
CoordinatesLat. (o)46.0072Long. (o)-89.6063Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F047014Metagenome / Metatranscriptome150Y
F057882Metagenome / Metatranscriptome135N
F063335Metagenome / Metatranscriptome129N

Sequences

Protein IDFamilyRBSSequence
Ga0208105_10051582F063335AGTAGVKIKKARVIDMERQVIEELQKVREERLALERAVMQICSSSRHPEWLGLTLIKNYHLIEAINKLVRKEKALTAEINYERKEQ
Ga0208105_10051586F057882AGAAGMSCGDNLKEFDHPEYGILNPSQVKELRDELTRSFIDYIGSLSDHLREREAIDIEKDRVTRSYYLRVCATIQNLNKIDPGWCLRYFAPDDECLKIKLHDCKCCYHTCQELNKVIQSPKSNSNKSSQTKDKELTQE
Ga0208105_10051587F047014N/AMSNQLNEARDQWIRYLINSTIAWIEAKRDKEAKHRCAKIINIIQKLKKLDQQWYLGNSVPKRNLIPTQYNSQSSYHTLQGA

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.