NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0209557_1002396

Scaffold Ga0209557_1002396


Overview

Basic Information
Taxon OID3300025483 Open in IMG/M
Scaffold IDGa0209557_1002396 Open in IMG/M
Source Dataset NameMarine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - Saanich Inlet SI074_LV_120m_DNA (SPAdes)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)9663
Total Scaffold Genes25 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)25 (100.00%)
Novel Protein Genes4 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)4 (100.00%)
Associated Families4

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Intertidal Zone → Unclassified → Marine → Marine Microbial Communities From Expanding Oxygen Minimum Zones In The Northeastern Subarctic Pacific Ocean

Source Dataset Sampling Location
Location NameSaanich Inlet, British Columbia, Canada
CoordinatesLat. (o)48.6Long. (o)-123.5Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F001588Metagenome / Metatranscriptome667Y
F040050Metagenome / Metatranscriptome162Y
F041087Metagenome / Metatranscriptome160Y
F103012Metagenome / Metatranscriptome101Y

Sequences

Protein IDFamilyRBSSequence
Ga0209557_100239610F103012GGAGMETILIALCIAICGGLIGYLFGYRTGSNDIEQVYKDVYDIKDY
Ga0209557_100239614F001588GAGGMQTTTQTNNYVFLAAEDAAIVVRVNNVTVAADVQTADALVQVFLTHNINVLTDTIMCSSSIDFAAEEGFATDSCAHNIIDAALDALE
Ga0209557_100239620F041087AGGAGGMAVDLWDKVCEQIEHDVRDPLNDMTALYTMLQQVPKDVLIAYLPESELDDDYV
Ga0209557_10023969F040050GAGGMNDLFEIVEDLEDIDTFGSDTTAFEDIIVKWKARLLDAQDAAERQFELFEMDDGA
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.