NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0208041_1000518

Scaffold Ga0208041_1000518


Overview

Basic Information
Taxon OID3300025393 Open in IMG/M
Scaffold IDGa0208041_1000518 Open in IMG/M
Source Dataset NameActive sludge microbial communities of municipal wastewater-treating anaerobic digesters from China - AD_SCU002_MetaG (SPAdes)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)36233
Total Scaffold Genes86 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)73 (84.88%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)3 (100.00%)
Associated Families3

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Engineered → Wastewater → Anaerobic Digestor → Unclassified → Unclassified → Anaerobic Digestor Sludge → Active Sludge Microbial Communities Of Municipal Wastewater-Treating Anaerobic Digesters From Various Locations

Source Dataset Sampling Location
Location NameChina: Chengdu, Sichuan
CoordinatesLat. (o)30.66Long. (o)104.06Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F082738Metagenome / Metatranscriptome113N
F085739Metagenome / Metatranscriptome111N
F090426Metagenome / Metatranscriptome108N

Sequences

Protein IDFamilyRBSSequence
Ga0208041_100051851F082738AGGAMKVNAKGRRCAPTVTAKRLEQFPGKGTAYIRENTPNPRLTRPEDHGWTEISDAEIAKFARLGYDVWYKTASMGGAHRVYRSLKKAGQK
Ga0208041_100051873F085739GGAGMSGIPIAGETCCANCVSDATCSHRSDLPGIALICDQFLNRTFPPEVQDEIRAGDRCHICGAPAIIGGGGRLTCGTCLIAQAAAKVRIGNKAIREWLGTVAIVPVPTGDAGADPDDIPEEDEEEAL
Ga0208041_100051878F090426AGGAGGMVTWKQVIERHGADLAEKMVATGLLDGITCVLLPSGEADIPQCDIDRALRAVRGLPVHDW

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.