Basic Information | |
---|---|
Taxon OID | 3300025310 Open in IMG/M |
Scaffold ID | Ga0209172_10004211 Open in IMG/M |
Source Dataset Name | Hot spring sediment bacterial and archeal communities from British Columbia, Canada, to study Microbial Dark Matter (Phase II) - Larsen N4 metaG (SPAdes) |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | DOE Joint Genome Institute (JGI) |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 19969 |
Total Scaffold Genes | 20 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 13 (65.00%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
All Organisms → cellular organisms → Bacteria | (Source: IMG/M) |
Source Dataset Ecosystem |
---|
Environmental → Aquatic → Thermal Springs → Sediment → Unclassified → Hot Spring Sediment → Bacterial And Archaeal Communities From Various Locations To Study Microbial Dark Matter (Phase Ii) |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | Canada: British Columbia | |||||||
Coordinates | Lat. (o) | 60.1987 | Long. (o) | -125.5127 | Alt. (m) | Depth (m) | Location on Map | |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F005155 | Metagenome / Metatranscriptome | 410 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0209172_1000421110 | F005155 | GGAG | MNLYEITVRGVDSFYLLAASKYRALELLGDYLADAGYPNSLQDGRFVARQIDLAEEQVLRPEKCRACPLNE |
⦗Top⦘ |