| Basic Information | |
|---|---|
| Taxon OID | 3300025285 Open in IMG/M |
| Scaffold ID | Ga0208046_1060553 Open in IMG/M |
| Source Dataset Name | Freshwater microbial communities from Powell Lake, British Columbia, Canada to study Microbial Dark Matter (Phase II) - PL_2010_300m (SPAdes) |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 700 |
| Total Scaffold Genes | 4 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 2 (50.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| Not Available | (Source: ) |
| Source Dataset Ecosystem |
|---|
| Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater → Bacterial And Archaeal Communities From Various Locations To Study Microbial Dark Matter (Phase Ii) |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Canada: British Columbia | |||||||
| Coordinates | Lat. (o) | 50.0621 | Long. (o) | -124.7214 | Alt. (m) | Depth (m) | 300 | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F016267 | Metagenome | 248 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0208046_10605532 | F016267 | AGGTGG | MSTERELAEHGIEIKHIQTDVDTLMEDMNELKRRLDAIESALNEIKGGWKVFIFIAGLASAVVSWAVTHWFK |
| ⦗Top⦘ |
 |
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |