NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0208814_1002092

Scaffold Ga0208814_1002092


Overview

Basic Information
Taxon OID3300025276 Open in IMG/M
Scaffold IDGa0208814_1002092 Open in IMG/M
Source Dataset NameMarine viral communities from the Global Malaspina Expedition - Malaspina viral metaG Antarct_55 (SPAdes)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)8788
Total Scaffold Genes16 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)2 (12.50%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families3

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Oceanic → Unclassified → Deep Ocean → Deep Ocean Microbial Communities From The Global Malaspina Expedition

Source Dataset Sampling Location
Location NameSouth Georgia Island
CoordinatesLat. (o)-50.35Long. (o)-39.82Alt. (m)Depth (m)4
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F000751Metagenome / Metatranscriptome907Y
F014160Metagenome / Metatranscriptome265N
F025069Metagenome / Metatranscriptome203N

Sequences

Protein IDFamilyRBSSequence
Ga0208814_100209210F014160N/AMKTLKDSIPELAAPFIDWESDHDNEVLQQDFVEARLGEYGVEFSIYASRDVSYSHGTHFETEDVTLGDSHFDIEILAVFDQHFDDIEITDEEEELLINVIANHYE
Ga0208814_10020922F000751N/AMMQIYKTNFPTEQQGKDYLLNLGVIIEVEGEIVFAKNTAAVVYIGKVVKIPATYDDEGNIITPAIFYDGFAIDVMSSEILDFGTYEVFPADKAAHSFYGWAKNAEVPPTEE
Ga0208814_10020923F025069N/AMYKIIADYMALGLWGMSMANTITSFDIASASSIAQLILSVLGIVYLGVKIVNETLNGRVEREGKRIANEINNRELDEEL
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.