NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0208568_1012672

Scaffold Ga0208568_1012672


Overview

Basic Information
Taxon OID3300025269 Open in IMG/M
Scaffold IDGa0208568_1012672 Open in IMG/M
Source Dataset NameMarine microbial communities from the Deep Atlantic Ocean - MP2969 (SPAdes)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)1689
Total Scaffold Genes4 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)3 (75.00%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)2 (100.00%)
Associated Families2

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Oceanic → Unclassified → Deep Ocean → Deep Ocean Microbial Communities From The Global Malaspina Expedition

Source Dataset Sampling Location
Location NameSouth of Funchal, North Atlantic Ocean
CoordinatesLat. (o)32.08Long. (o)-17.26Alt. (m)Depth (m)4002.6
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F000245Metagenome / Metatranscriptome1468Y
F002745Metagenome533Y

Sequences

Protein IDFamilyRBSSequence
Ga0208568_10126721F002745GAGMKSFKGYLTEFAMQSTSDYVFNAGSDSSALKIPISGPMFKRIWPDTIRTTVFHATDLKGLANLKKLEGGKKSISAFFSMMSRYMETGVATEGGGIVAEMDADVLVSARDDIMSEVDKQGRRWVMMSWFENQTRDRSKFGKVENDLNGLIKQLVLKHLGPILGKEDVKKLSEFDLWSNMKRHLKGDGRKIAAVIKDYFDGVEKIIKKNKEVMGDIFYGYTKSKRMTDNSWDEQIVNNIDIYKIHVIKPHPSSDVWGPDEIKQHITDVHKWP
Ga0208568_10126722F000245AGGAMKTFKQFDETKLDDKLDKLVSDEIKKRKLAKFPVNATDDIKMRMKPNKPVFKFKSPNSDMMIHVFLKKMLPSKGQPKGMMAFNYQLEDK
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.