NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0208060_1056536

Scaffold Ga0208060_1056536


Overview

Basic Information
Taxon OID3300025262 Open in IMG/M
Scaffold IDGa0208060_1056536 Open in IMG/M
Source Dataset NameMarine microbial communities from the Deep Indian Ocean - MP0901 (SPAdes)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)503
Total Scaffold Genes1 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families1

Taxonomy
All Organisms → cellular organisms → Bacteria → FCB group → Candidatus Marinimicrobia → Candidatus Marinimicrobia bacterium(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Oceanic → Unclassified → Deep Ocean → Deep Ocean Microbial Communities From The Global Malaspina Expedition

Source Dataset Sampling Location
Location NameEast of Durban, South Africa, South Indian Ocean
CoordinatesLat. (o)-33.55Long. (o)39.89Alt. (m)Depth (m)4002.12
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F082562Metagenome113N

Sequences

Protein IDFamilyRBSSequence
Ga0208060_10565361F082562N/AQASDSSNNYFFNIELSLIHPILGGFGGTVGIEKNHFSYGLNSFGTKLNHMTKHYLLENAEELAVYNWGVELYSDYYFKQNHTGLFLGLILSLNGFRFNDIPNPQTILVLYSAPRIGYRLCLPKKLKSFYFQYSLTTHFKVWDDEKKFLYREIDTKSIFLLSQLTLGV

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.