Basic Information | |
---|---|
Taxon OID | 3300025248 Open in IMG/M |
Scaffold ID | Ga0207904_1057661 Open in IMG/M |
Source Dataset Name | Marine viral communities from the Deep Pacific Ocean - MSP-118 (SPAdes) |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | DOE Joint Genome Institute (JGI) |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 649 |
Total Scaffold Genes | 3 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 2 (66.67%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sneathiellales → Sneathiellaceae → Sneathiella → unclassified Sneathiella → Sneathiella sp. | (Source: UniRef50) |
Source Dataset Ecosystem |
---|
Environmental → Aquatic → Marine → Oceanic → Unclassified → Deep Ocean → Deep Ocean Microbial Communities From The Global Malaspina Expedition |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | Pacific Ocean | |||||||
Coordinates | Lat. (o) | 11.9811 | Long. (o) | -108.0335 | Alt. (m) | Depth (m) | Location on Map | |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F042375 | Metagenome / Metatranscriptome | 158 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0207904_10576612 | F042375 | AGGAG | MITYRAEARHIDVLWPYAEPLLNKAIKRTIGEVGLEDVKKWLKEGRQQLWLILDKEEQEIIVAFTTEIYIYPNHRHLRGHLWGAKRNTIKKWIDIWSEPVEKFCRENNISHIETAGRDGWTRVLKDKGYKKYYTVLVKEIGND |
⦗Top⦘ |