NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0208830_1013431

Scaffold Ga0208830_1013431


Overview

Basic Information
Taxon OID3300025238 Open in IMG/M
Scaffold IDGa0208830_1013431 Open in IMG/M
Source Dataset NameMarine microbial communities from the Deep Atlantic Ocean - MP2634 (SPAdes)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)1930
Total Scaffold Genes7 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)4 (57.14%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (50.00%)
Associated Families2

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Oceanic → Unclassified → Deep Ocean → Deep Ocean Microbial Communities From The Global Malaspina Expedition

Source Dataset Sampling Location
Location NameNortheast of Antigua and Barbuda, North Atlantic Ocean
CoordinatesLat. (o)20.0Long. (o)-52.63Alt. (m)Depth (m)4002.69
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F011155Metagenome / Metatranscriptome294Y
F011704Metagenome / Metatranscriptome288Y

Sequences

Protein IDFamilyRBSSequence
Ga0208830_10134311F011704N/ANFQELIDLTDYLDLTNEYLIRKFKEGGSYLIIDTYGDFLILKRDEVDTVTNIIWNDLYGPISEEIPHILN
Ga0208830_10134312F011155AGGAGMLDIVVDGVGYVDVMTDSLYVLREGAFGFLTEAKESPYPWMFAAAYIAGALPLALVFFGFGWIECSREAVQCGLVSIGG

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.