NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0209498_1092075

Scaffold Ga0209498_1092075


Overview

Basic Information
Taxon OID3300025135 Open in IMG/M
Scaffold IDGa0209498_1092075 Open in IMG/M
Source Dataset NameLake sediment microbial communities from Walker lake, Nevada to study Microbial Dark Matter (Phase II) - Walker Lake 11/02/13 Deep Sediment (SPAdes)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)1249
Total Scaffold Genes4 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)3 (75.00%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)2 (100.00%)
Associated Families2

Taxonomy
All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Saprospiria → Saprospirales → unclassified Saprospirales → Saprospirales bacterium(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Sediment → Unclassified → Sediment → Bacterial And Archaeal Communities From Various Locations To Study Microbial Dark Matter (Phase Ii)

Source Dataset Sampling Location
Location NameUSA: Hawthorne, Nevada
CoordinatesLat. (o)38.7Long. (o)-118.7Alt. (m)Depth (m)0
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F003027Metagenome / Metatranscriptome512Y
F006543Metagenome / Metatranscriptome370Y

Sequences

Protein IDFamilyRBSSequence
Ga0209498_10920751F006543AGGMKKFSFVVDIVADDLDRDEVVGSIRSCLSESLSSDIHANVKAGEVKAFSEQGYKVWRARVTGVTAEQAGDAHNSKIEAEAVA
Ga0209498_10920754F003027AGGAGMKTANGNDKLGKENCIVVSRPVGDTCPSDCDFLGNGCYAEDLENIYPGVRPAGMQNLITEKNRIRSMLVDAVKKNKDVRWHERGDFFKYGELDNEYVDNVLWACESILADGGSLPTMWAYTHIYDTRLSMELGKYVNMYASVHNGEHMKKA

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.