NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0209232_1000903

Scaffold Ga0209232_1000903


Overview

Basic Information
Taxon OID3300025132 Open in IMG/M
Scaffold IDGa0209232_1000903 Open in IMG/M
Source Dataset NameMarine viral communities from the Pacific Ocean - ETNP_2_60 (SPAdes)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)17000
Total Scaffold Genes25 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)5 (20.00%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (50.00%)
Associated Families2

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine → Marine Viral Communities From The Subarctic Pacific Ocean And The Gulf Of Mexico

Source Dataset Sampling Location
Location NamePacific Ocean
CoordinatesLat. (o)18.92Long. (o)-108.7999Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F019650Metagenome / Metatranscriptome228N
F068870Metagenome / Metatranscriptome124Y

Sequences

Protein IDFamilyRBSSequence
Ga0209232_100090311F019650AGGMMIEKIKLYAKTLRPLLEWLKENPNDKDVKYTVTRLLRFYSNTPKELGIPYMYSRAALQKAQRLEIPDAEEKLKWVTWRQQTNKTGLKDSGRIDGVFHLEHIVPISQIAKKLYDLEDTSIRTIYAILVNNFKIAWILKTEQKVLDEVNRSGERTPKELTNLNIFIKGYNY
Ga0209232_100090322F068870N/AMEVPTSKPSCIEDLKELVNNLSDRDISIKNHISCIKKVIEDKRIKCDTVKIKKIKQILKD

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.