NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0209349_1005722

Scaffold Ga0209349_1005722


Overview

Basic Information
Taxon OID3300025112 Open in IMG/M
Scaffold IDGa0209349_1005722 Open in IMG/M
Source Dataset NameMarine viral communities from the Pacific Ocean - ETNP_2_130 (SPAdes)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)5322
Total Scaffold Genes13 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)10 (76.92%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)2 (66.67%)
Associated Families3

Taxonomy
All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine → Marine Viral Communities From The Subarctic Pacific Ocean And The Gulf Of Mexico

Source Dataset Sampling Location
Location NamePacific Ocean
CoordinatesLat. (o)18.92Long. (o)-108.7999Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F000747Metagenome / Metatranscriptome908Y
F000929Metagenome / Metatranscriptome830Y
F021556Metagenome / Metatranscriptome218N

Sequences

Protein IDFamilyRBSSequence
Ga0209349_10057222F021556AGGAGGVAAKSKFPTLWDLKMQRRLESLFDRGGTLVEAAREMGISRSTFTAWANSTDKQKESFRDTVKIGKEAAEAWWIRQGRENLETRGFNHGLWLINMVNRFGWTSSHSKKEEKKEVEHTVEVKKKVDVDAILDKAIKKGVEEIEKTIH
Ga0209349_10057228F000929GGAGMSNGTQLSKSISVGHIVATVGLIIGGFTFIYDLRENVAIQAFQLDSVEKRLERVVARTDDQFGEIMDHLVRLEEKLDAMVLPNPVYQKAR
Ga0209349_10057229F000747N/AMKRLLLALLLALPLSGSARMFPTEFPIKAICWDDITEVLQYHQEVLGEYPIGKGWINSKDGPSFGAVMYNPTKPSWTFLTFHKKEGQEAVIICAITGGSMWEIIHPGDESEKLEL
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.