| Basic Information | |
|---|---|
| Taxon OID | 3300025101 Open in IMG/M |
| Scaffold ID | Ga0208159_1024441 Open in IMG/M |
| Source Dataset Name | Marine viral communities from the Subarctic Pacific Ocean - 9_ETSP_OMZ_AT15188 metaG (SPAdes) |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 1428 |
| Total Scaffold Genes | 5 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 2 (40.00%) |
| Novel Protein Genes | 2 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (50.00%) |
| Associated Families | 2 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium | (Source: UniRef50) |
| Source Dataset Ecosystem |
|---|
| Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine → Marine Viral Communities From The Subarctic Pacific Ocean And The Gulf Of Mexico |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Pacific Ocean | |||||||
| Coordinates | Lat. (o) | -14.198 | Long. (o) | -77.499 | Alt. (m) | Depth (m) | 38 | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F002445 | Metagenome | 558 | Y |
| F010922 | Metagenome / Metatranscriptome | 297 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0208159_10244413 | F002445 | N/A | MIINGCQNSHMTMLTGKPRICPECKGNGYLRTEMQTIVQCLTCWSEGEINEKIWARNYDPIIPDELQSTQKDD |
| Ga0208159_10244414 | F010922 | GAGG | MGKYRTPFANNDVIHLIEQNKEPEQKLWVAVLAKAFDDAFYCTDNRAALEALSWIRHGMDFNYVCHLAGRDPKYVKKKMLDKVIAREASILMEHKRIKQGVDNIIKLKLKKRGPVPGTQKKVYDYKWLPKQSHDYVDR |
| ⦗Top⦘ |
 |
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |