| Basic Information | |
|---|---|
| Taxon OID | 3300025082 Open in IMG/M |
| Scaffold ID | Ga0208156_1026177 Open in IMG/M |
| Source Dataset Name | Marine viral communities from the Subarctic Pacific Ocean - 1_ETSP_OMZ_AT15124 metaG (SPAdes) |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 1278 |
| Total Scaffold Genes | 3 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 1 (33.33%) |
| Novel Protein Genes | 2 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (50.00%) |
| Associated Families | 2 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | (Source: UniRef50) |
| Source Dataset Ecosystem |
|---|
| Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine → Marine Viral Communities From The Subarctic Pacific Ocean And The Gulf Of Mexico |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Pacific Ocean | |||||||
| Coordinates | Lat. (o) | -13.003 | Long. (o) | -80.809 | Alt. (m) | Depth (m) | 275 | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F023211 | Metagenome / Metatranscriptome | 211 | Y |
| F034603 | Metagenome | 174 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0208156_10261772 | F034603 | AGAAG | MITFKQYLKEGPPKWTESLSTMLFDLPRAGLKDVLIPLSPAILKRIWPKPPRTTVFHLTDYTGVGKLKGLQGKQKSISAFFNITPRAIEYGVATEGGYVVELIGDILAAAPDDLSTRPDKTGRRWMAFSTLINPIDYGHFGDGIGGGKKLKGMENDISEMLIEIIMQYADDPGKSGMPNVNKSWIALGKEYGSRSREDNKIKSQIIKDYLDGMEKIMKKYSAKLKSVLLDYVKIRASKPDPDSGDVPEWDELVVNNFKIQKIHVNPEFSPDFEDDDDIDGFPFELYDDAGDMVDYINRKTLDIKL |
| Ga0208156_10261773 | F023211 | N/A | MIRFKQYLREFAQRSTSEYVFDTHSVNSSSLKIPISGPMFKRIWPNTIRATVFHTTDLAGLERLGKLEGGKK |
| ⦗Top⦘ |
 |
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |