NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0208668_1013552

Scaffold Ga0208668_1013552


Overview

Basic Information
Taxon OID3300025078 Open in IMG/M
Scaffold IDGa0208668_1013552 Open in IMG/M
Source Dataset NameMarine viral communities from the Subarctic Pacific Ocean - 18_ETSP_OMZAT15316 metaG (SPAdes)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)1732
Total Scaffold Genes4 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)3 (75.00%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)2 (100.00%)
Associated Families2

Taxonomy
All Organisms → cellular organisms → Bacteria → Proteobacteria(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine → Marine Viral Communities From The Subarctic Pacific Ocean And The Gulf Of Mexico

Source Dataset Sampling Location
Location NamePacific Ocean
CoordinatesLat. (o)-16.21Long. (o)-76.61Alt. (m)Depth (m)250
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F008452Metagenome / Metatranscriptome333Y
F009368Metagenome / Metatranscriptome319N

Sequences

Protein IDFamilyRBSSequence
Ga0208668_10135521F008452GGAGMVTSLNLCSTNATGLDTTRPVDNAWEKTKVRELVLVEWVDIISDDGWVVAEDCHLPTFYSVGWLEYQDDKVLKICNTLDFDDFTEEHKKKEKPIGYSVTCFPAGCVTSLSFLNSRNDVS
Ga0208668_10135523F009368AGGVSDVSLTTIMLFHFEAAMQMMDDILTNELVNPDELYEILEYKQKTSDTIQEERLWKMLQGFLVGANRLPADVIPFSPELRGPDVGKD

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.