NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0207901_1011475

Scaffold Ga0207901_1011475


Overview

Basic Information
Taxon OID3300025045 Open in IMG/M
Scaffold IDGa0207901_1011475 Open in IMG/M
Source Dataset NameMarine viral communities from the Pacific Ocean - LP-46 (SPAdes)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)1235
Total Scaffold Genes4 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)4 (100.00%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)2 (100.00%)
Associated Families2

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine → Marine Viral Communities From The Subarctic Pacific Ocean And The Gulf Of Mexico

Source Dataset Sampling Location
Location NamePacific Ocean
CoordinatesLat. (o)49.9991Long. (o)-144.9989Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F034348Metagenome / Metatranscriptome175Y
F038858Metagenome / Metatranscriptome165Y

Sequences

Protein IDFamilyRBSSequence
Ga0207901_10114751F034348AGGAMMETQVQKQTVKAPISERVTEKVMPLTKWFAEQYFQTAELMRSDPRYKELPNYNQTSCIATVIIATNTALDSDRAKKRAEKMIEISNRADQAKTA
Ga0207901_10114752F038858GGAGGMKRIEKVGEVLVKTFTLPIRICIGVYKCIEKSTPDTLEMPFIIKRKEENDGNASTKTNS

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.