NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0207878_133323

Scaffold Ga0207878_133323


Overview

Basic Information
Taxon OID3300025039 Open in IMG/M
Scaffold IDGa0207878_133323 Open in IMG/M
Source Dataset NameMarine viral communities from the Pacific Ocean - LP-41 (SPAdes)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)507
Total Scaffold Genes2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families2

Taxonomy
All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine → Marine Viral Communities From The Subarctic Pacific Ocean And The Gulf Of Mexico

Source Dataset Sampling Location
Location NamePacific Ocean
CoordinatesLat. (o)49.9984Long. (o)-144.9944Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F046418Metagenome / Metatranscriptome151Y
F100970Metagenome102Y

Sequences

Protein IDFamilyRBSSequence
Ga0207878_1333231F100970N/AMTKIQKIILDHYRKICDEETALRMISDHKNNFKIFLGSLEKKLESRKPMENYE
Ga0207878_1333232F046418N/AMVSIRNVRMFKYETYLEKKWLERHGIWEYPIYLRETHGRVKDEQRGEHCSGESYKVSHLKDINMNWSLHLWYALTLAGRLFLLSLIAVAHGMLPFIFTSKVSDGVASLDSELKK

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.