NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0256306_1014041

Scaffold Ga0256306_1014041


Overview

Basic Information
Taxon OID3300024560 Open in IMG/M
Scaffold IDGa0256306_1014041 Open in IMG/M
Source Dataset NameMetatranscriptome of freshwater microbial communities from Columbia River, Oregon, United States - Colum_Law_RepC_8d (Metagenome Metatranscriptome)
Source Dataset CategoryMetatranscriptome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)2000
Total Scaffold Genes6 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)2 (33.33%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (50.00%)
Associated Families2

Taxonomy
All Organisms → cellular organisms → Archaea → unclassified Archaea → archaeon(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → River → Unclassified → Freshwater → Freshwater Microbial Communities Amended With Dissolved Organic Matter (Dom) From Various Rivers In The United States

Source Dataset Sampling Location
Location NameUSA: Oregon
CoordinatesLat. (o)46.1812Long. (o)-123.1834Alt. (m)Depth (m)5
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F013886Metagenome / Metatranscriptome267N
F090299Metagenome / Metatranscriptome108N

Sequences

Protein IDFamilyRBSSequence
Ga0256306_10140412F090299AGGMKKVIVSKVEYEFLVSLLEELYIISPDETISDKWISKLEPTKKLFDLELEFYNIRNDNQTPTKKEMVKWLLTKIKNKNLDL
Ga0256306_10140413F013886N/AMNNTIEKPNAFAFKAKVGESQEIQLCICIRENDKWLENEIFSIPEGHPELSPYIDEQLFNIVFIGYERDENKEGFWIKHQNSFYMKSDTILTEDLLNNGEFFTTIEKGYQSFYEQSITSEREGEQTSSSEQENL

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.