NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0256308_1000003

Scaffold Ga0256308_1000003


Overview

Basic Information
Taxon OID3300024549 Open in IMG/M
Scaffold IDGa0256308_1000003 Open in IMG/M
Source Dataset NameMetatranscriptome of freshwater microbial communities from Columbia River, Oregon, United States - Colum_Atlam_RepC_8d (Metagenome Metatranscriptome)
Source Dataset CategoryMetatranscriptome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)32040
Total Scaffold Genes50 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)10 (20.00%)
Novel Protein Genes4 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families4

Taxonomy
All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → River → Unclassified → Freshwater → Freshwater Microbial Communities Amended With Dissolved Organic Matter (Dom) From Various Rivers In The United States

Source Dataset Sampling Location
Location NameUSA: Oregon
CoordinatesLat. (o)46.1812Long. (o)-123.1834Alt. (m)Depth (m)5
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F031091Metagenome / Metatranscriptome183Y
F061656Metagenome / Metatranscriptome131Y
F061834Metagenome / Metatranscriptome131Y
F066569Metagenome / Metatranscriptome126Y

Sequences

Protein IDFamilyRBSSequence
Ga0256308_100000318F061834N/AMVLKKELRKTLNNYLKGSVQIKEKDMAREVVEKKLFIENIILLREIEDRRDFMEEELGLDMSVYEEKFLQIIENLFKIHFSKEQFALIQYYIYQVPTLDNWDGKIDLSDGKDMITVDFETPEQVWNVITSLKK
Ga0256308_100000319F061656N/AMSKFCFYSKNDPTQEPVGVVEALSKEEAVKFFSLSKMLPVNDFLIIFEVKNYTYGAQEGIKENTKQLLKG
Ga0256308_10000037F066569N/AMDREKYIQMRKSGQYDLAWFYQYFLENKDSSRVTPPFEIFQQAFNMYFQMNGRVMLENLDKKMQVTKIEDEQGKLIYID
Ga0256308_10000039F031091N/AMKKLVSIFTCEHTGIITTYTYRTHSITSGIEKAEFEYPKGYLEEFAKKEKIKANLPKTKQMFLNPKTGKEVSYYRAKTLGLVD
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.