| Basic Information | |
|---|---|
| Taxon OID | 3300024506 Open in IMG/M |
| Scaffold ID | Ga0255168_1024710 Open in IMG/M |
| Source Dataset Name | Freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Miss_RepB_8d |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 1042 |
| Total Scaffold Genes | 3 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 1 (33.33%) |
| Novel Protein Genes | 2 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (50.00%) |
| Associated Families | 2 |
| Taxonomy | |
|---|---|
| All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | (Source: UniRef50) |
| Source Dataset Ecosystem |
|---|
| Environmental → Aquatic → Freshwater → River → Unclassified → Freshwater → Freshwater Microbial Communities Amended With Dissolved Organic Matter (Dom) From Various Rivers In The United States |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | USA: Georgia | |||||||
| Coordinates | Lat. (o) | 31.4271 | Long. (o) | -81.6053 | Alt. (m) | Depth (m) | 5 | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F002085 | Metagenome / Metatranscriptome | 595 | Y |
| F071232 | Metagenome | 122 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0255168_10247101 | F071232 | N/A | TADVQRGGGSTVNVPVHRNLIATLTSTVPCVAGEYGTTVAMGGTTYTGVTFPVVMRAYPTYNLVPITNDSFISWTGSFQALEQVL |
| Ga0255168_10247102 | F002085 | AGCAGG | VNVITPVEGTSNIRIADFLRITTTSGTYLMTTAPSDLTVAAVDASPFQSVGTLLAIGEVQRDIKSTANDTTITLSGIDTAMLGFVLGQNVKGSSIQLWHGFFDTNGALITTGGTGGLYQYFNGIITSFAISEQWMDDLRMYVGTISVSASSIQLILQNRIAGRYTNNSSWQFYNSGDTSMNRVPFIETINYQFGKDAPPNS |
| ⦗Top⦘ |
 |
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |