NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0244776_10007667

Scaffold Ga0244776_10007667


Overview

Basic Information
Taxon OID3300024348 Open in IMG/M
Scaffold IDGa0244776_10007667 Open in IMG/M
Source Dataset Name0.2um to 3um size fraction coassembly
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)9608
Total Scaffold Genes20 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)13 (65.00%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)2 (100.00%)
Associated Families2

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine → Estuarine Microbial Communities From The Columbia River Estuary, To Analyze Effect Of Nutrient Fluxes, A Time Series

Source Dataset Sampling Location
Location NameColumbia River Estuary, USA
CoordinatesLat. (o)46.234Long. (o)-123.9135Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F000369Metagenome / Metatranscriptome1222Y
F000376Metagenome / Metatranscriptome1216Y

Sequences

Protein IDFamilyRBSSequence
Ga0244776_100076677F000369AGAAGMEIELADHFDRMNKVVEELLRGNNPTQIATLTGLKRADVIGLIDEWKNVVHNDTSARERAKEAISGADQHYAMLIKEAWKTVEDADQAGQLSVKSGALKLIADIEGKRIGMLQEVGLLDNAELAGQIAESERKQEVLVRILKEVTASCPKCKMEVAKRLSQITGIVEPIEIIEEVSGV
Ga0244776_100076679F000376GGAMSIYQEKAKECKCCSKHVPLPTRLKEYNGILICPTTFDNIHEYRRVWSDIGHRPPGSIRKHFSEYVQQIVEQSIDKTDSKIL

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.