NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0228671_1038735

Scaffold Ga0228671_1038735


Overview

Basic Information
Taxon OID3300024334 Open in IMG/M
Scaffold IDGa0228671_1038735 Open in IMG/M
Source Dataset NameSeawater microbial communities from Monterey Bay, California, United States - 89D
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)1303
Total Scaffold Genes3 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)1 (33.33%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (50.00%)
Associated Families2

Taxonomy
All Organisms → cellular organisms → Bacteria → FCB group → Candidatus Marinimicrobia → Candidatus Marinimicrobia bacterium(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Coastal → Unclassified → Seawater → Seawater Microbial Communities From Monterey Bay, California, United States

Source Dataset Sampling Location
Location NameUSA: California
CoordinatesLat. (o)36.8313Long. (o)-121.9047Alt. (m)Depth (m)5
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F005298Metagenome / Metatranscriptome405Y
F021205Metagenome220Y

Sequences

Protein IDFamilyRBSSequence
Ga0228671_10387352F005298GGAGMTTNKKFILIRAAANIISGLSMVTIITLGIMYMSFDNEFVFTDTHISVTNNPVTKDKDIEFYMVGSKKYQCNSTAAYGVAHAIDGSHSHKLNTFTKRYIQATSPGERVENGWHMAVPDDMVEGGEYRVSMTGEFECVHMIFKTHKKQVFDNIYLKVDPR
Ga0228671_10387353F021205N/AAQVERWDLFARLVPTVFLVINLILVSTGVLNFEQAFWVGLGLFAITAVTWWFWTIYTIRHLVKTLNRASKNLAEVRDEFKSVSHDLENFKHDN

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.