NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0210003_1000536

Scaffold Ga0210003_1000536


Overview

Basic Information
Taxon OID3300024262 Open in IMG/M
Scaffold IDGa0210003_1000536 Open in IMG/M
Source Dataset NameDeep subsurface microbial communities from Baltic Sea to uncover new lineages of life (NeLLi) - Landsort_02402 metaG (SPAdes)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)34171
Total Scaffold Genes75 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)20 (26.67%)
Novel Protein Genes4 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families4

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Oceanic → Sediment → Deep Subsurface → Deep Subsurface Microbial Communities From Various Oceans To Uncover New Lineages Of Life (Nelli)

Source Dataset Sampling Location
Location NameBaltic Sea
CoordinatesLat. (o)58.622Long. (o)18.254Alt. (m)Depth (m)437
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F022610Metagenome / Metatranscriptome213Y
F023869Metagenome / Metatranscriptome208Y
F041785Metagenome / Metatranscriptome159N
F060727Metagenome / Metatranscriptome132N

Sequences

Protein IDFamilyRBSSequence
Ga0210003_100053616F022610N/AMEDKKYIITETQLKNIVKTVIKEQGLYGDASDVVDYDLPEYLSDVIILSDLESFNDVEKSVKELHKRLIRLEKGLTSGGSHNKAYRTGSDYSSINKKSKDIETKVDSIERDEELRREIEMLQQMIRDNE
Ga0210003_100053632F041785N/AMKYKLELYGWEVEAIGHSLTDEQVKLIKDLMDTNGADELWEVRYDLENEGIINDLYNPDLYHVSRALDNSGLWFSLKDENDNEVLSFEPSDMSDIYETLGDSADDIPYEGYLSIPGEGENENVDNILATFDENKGGICEYEMFESDEVPTAKDFCIQYGDISTPDGDWDFISKVFYKGKELEVYDHLDNRGKASTVEIYRKDGSTIS
Ga0210003_100053634F060727N/AMKLKIRGEKYDVYGQFYIIPTVKVTHNKYLYGYYTIDLVWGKWGLSLTFE
Ga0210003_100053657F023869N/AMSYKNKNGESEYLFGWLEAKPGSKEFKPTSGGNSVWAKSKREAIAKVNRGRKEFEKENPTYTQLRVNPETCRRAKTYKESADFSYGLYLMTI
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.