NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0228603_1000025

Scaffold Ga0228603_1000025


Overview

Basic Information
Taxon OID3300024183 Open in IMG/M
Scaffold IDGa0228603_1000025 Open in IMG/M
Source Dataset NameSeawater microbial communities from Monterey Bay, California, United States - 3D
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)23307
Total Scaffold Genes29 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)20 (68.97%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)3 (100.00%)
Associated Families3

Taxonomy
All Organisms → cellular organisms → Bacteria → Proteobacteria(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Coastal → Unclassified → Seawater → Seawater Microbial Communities From Monterey Bay, California, United States

Source Dataset Sampling Location
Location NameUSA: California
CoordinatesLat. (o)36.8313Long. (o)-121.9047Alt. (m)Depth (m)5
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F022909Metagenome / Metatranscriptome212Y
F023957Metagenome / Metatranscriptome208Y
F034245Metagenome / Metatranscriptome175N

Sequences

Protein IDFamilyRBSSequence
Ga0228603_100002511F034245AGGAVRGISFTEFSGGQNVDMMMNAPDAKPGTPMQEAVNTARKIRKKFTKPLYVIQDYSVQHMYAQIAMQGFIMAGIDFVAAIPVLSNDLSKRENDCTIQYCKKRNIPYELFHIDVPHLFENEIEYYAEHFPTTQPQMTIMGKFFDMLPDCCIVYPGFMMHVSNSEWTRSKNNGFMPFVPHETQEHAASFFGKEYTNFQEHDVNMYTSWLFTESYGAVLKSPTQSFVDNAPHRYYQSEIRTIRQAGFDIEPTTEKLIGIELLKTFFGHDKYDKELRQRIAQFGYLTMKFASLQYTVKVDTALKQMLEEHHGADFEFINKLF
Ga0228603_10000252F023957AGGAGVSSKTPYEIRLELIQEARLILQAKSSKPENMPSTEDIISEAEKLNSFISKRPSDSAR
Ga0228603_10000258F022909AGGAMADTETLRTFFDGQIGCIEYTPAWQKELEEFCSVAKSLGYVSNESLDAMKVDKVKYHCMVHMHTNKIYAVGGVEHMPEYKQGYYRVWTRLARIPNADIPMNYRARFDRTIMPEFDGLLYFNCDWASKQKDFVATFGTTLANKSYSGSYVKSTTQITDYIKRNWWMRKGIAEPEGIFEFYKVPQVSWKIHHSKFKEISDEKIHKANSVQR
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.