| Basic Information | |
|---|---|
| Taxon OID | 3300024181 Open in IMG/M |
| Scaffold ID | Ga0247693_1047444 Open in IMG/M |
| Source Dataset Name | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK34 |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 617 |
| Total Scaffold Genes | 2 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 1 (50.00%) |
| Novel Protein Genes | 2 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (50.00%) |
| Associated Families | 2 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | (Source: UniRef50) |
| Source Dataset Ecosystem |
|---|
| Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil → Soil Microbial Communities From Purdue University Martell Research Forest, Indiana, United States |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | USA: Indiana | |||||||
| Coordinates | Lat. (o) | 40.4449 | Long. (o) | -87.0297 | Alt. (m) | Depth (m) | Location on Map | |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F002603 | Metagenome / Metatranscriptome | 544 | Y |
| F047252 | Metagenome / Metatranscriptome | 150 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0247693_10474441 | F047252 | GAGG | MKFLLLTGAHRAAVFSLLMCGHSLIARLTIAVFVFLMLGVTSVVHAERPDSTAGTSNAGTRKLFIDPSSTSVALRGKASLIVSPLAHRDGNYVGDYQLKVR |
| Ga0247693_10474442 | F002603 | N/A | DECVKLDNVEEHRVLTTLEVIYEGGSLHGKTADFPTRDVERVVVGLHLPNWHFFETYKRTICVDIRSQRTIFGYAGTFNPQQPAVWWTRLLTVLRIRKVRPIAI |
| ⦗Top⦘ |
 |
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |