NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0228708_1000747

Scaffold Ga0228708_1000747


Overview

Basic Information
Taxon OID3300023703 Open in IMG/M
Scaffold IDGa0228708_1000747 Open in IMG/M
Source Dataset NameMetatranscriptome of freshwater microbial communities from McNutts Creek, Athens, Georgia, United States - 20-17_Aug_MT (Metagenome Metatranscriptome)
Source Dataset CategoryMetatranscriptome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)4438
Total Scaffold Genes6 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)2 (33.33%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (50.00%)
Associated Families2

Taxonomy
All Organisms → cellular organisms → Eukaryota → Sar(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Creek → Unclassified → Freshwater → Freshwater Microbial Communities From Mcnutts Creek, Athens, Georgia, United States

Source Dataset Sampling Location
Location NameUSA: Georgia
CoordinatesLat. (o)33.9266Long. (o)-83.4611Alt. (m)Depth (m)0
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F001145Metagenome / Metatranscriptome765Y
F001219Metagenome / Metatranscriptome744Y

Sequences

Protein IDFamilyRBSSequence
Ga0228708_10007473F001145N/AMEWNTFSFFLNNEGVHLNPNILETNLVNILILIGVLVYANKVSFSVSLENRQKEIIQTIENAQKDVQTASDYYYLAEKGFTQSLFWLQSWKVLYQKDKIDLVNAKYNIVKKGLLETFNTTENLIKNFETRAFISLQKYMIFITASKILRKFLFLSEAEQSKLIQATISKLGGLKK
Ga0228708_10007474F001219GAGMNFSGTFFLNESGLFDFDLTFIAEGILFITLAFVVTFVFLSPISNQLDKREEFINYNLRKSTILLTYGYERLSTCLDLLTKEISEMNRQVKLVRNYTNTQFEEEVLSVQQQNSKILSKLKGDLSIKSAYLFSNVTNELISLTDNFFTKKFQSS
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.