Basic Information | |
---|---|
Taxon OID | 3300023444 Open in IMG/M |
Scaffold ID | Ga0256747_1291961 Open in IMG/M |
Source Dataset Name | Hydrothermal Fe-rich mat microbial community from Loihi Seamount, Hawaii, USA - 675-SC9 |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | University of Delaware |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 744 |
Total Scaffold Genes | 2 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 1 (50.00%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
Not Available | (Source: ) |
Source Dataset Ecosystem |
---|
Environmental → Aquatic → Marine → Hydrothermal Vents → Microbial Mats → Hydrothermal Fe-Rich Mat → Hydrothermal Fe-Rich Mat Reference Genomes |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | USA: Loihi Seamount, Hawaii | |||||||
Coordinates | Lat. (o) | 18.906379 | Long. (o) | -155.256927 | Alt. (m) | Depth (m) | 1299.98 | Location on Map |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F004651 | Metagenome / Metatranscriptome | 429 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0256747_12919612 | F004651 | AGGAGG | MTTHEQVISGTIENHYGAAHAHLTDDELLAEMEHIGAVLDGFKTTLGHLEMEVYRRIEERGATSIPSETYICEMETGFKYDQPSFGPLKEIFNEVDLKKCLTPAHTEEVKVADKWATGTVKSLATKYGAEALRIVEHAQTESRGRLKFARRETR |
⦗Top⦘ |