Basic Information | |
---|---|
Taxon OID | 3300023442 Open in IMG/M |
Scaffold ID | Ga0256751_1041135 Open in IMG/M |
Source Dataset Name | Hydrothermal Fe-rich mat microbial community from Rainbow Site, Mid-Atlantic Ridge, Atlantic Ocean - 664-SC8 |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | University of Delaware |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 1694 |
Total Scaffold Genes | 4 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 1 (25.00%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | (Source: IMG/M) |
Source Dataset Ecosystem |
---|
Environmental → Aquatic → Marine → Hydrothermal Vents → Microbial Mats → Hydrothermal Fe-Rich Mat → Hydrothermal Fe-Rich Mat Reference Genomes |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | International: Rainbow Site, Mid-Atlantic Ridge | |||||||
Coordinates | Lat. (o) | 36.229322 | Long. (o) | -33.902767 | Alt. (m) | Depth (m) | 2294.86 | Location on Map |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F105196 | Metagenome / Metatranscriptome | 100 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0256751_10411352 | F105196 | AGGA | MYIIDQCRGPYGQLSKSRKTLLEQLLKQPDQCIWERARGLIIRDIPIVTMEMAVNSVRRNSDAEQLPDPFTLYRALRFAVDYETGDAESVRGGICRK |
⦗Top⦘ |