NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0214921_10020790

Scaffold Ga0214921_10020790


Overview

Basic Information
Taxon OID3300023174 Open in IMG/M
Scaffold IDGa0214921_10020790 Open in IMG/M
Source Dataset NameFreshwater microbial communities from Lake Lanier, Atlanta, Georgia, United States - LL-1505
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)7008
Total Scaffold Genes17 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)13 (76.47%)
Novel Protein Genes4 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)4 (100.00%)
Associated Families4

Taxonomy
All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater → Freshwater Microbial Communities From Lake Lanier, Atlanta, Georgia, United States

Source Dataset Sampling Location
Location NameUSA: Georgia
CoordinatesLat. (o)34.2611Long. (o)-83.95Alt. (m)Depth (m)2
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F000369Metagenome / Metatranscriptome1222Y
F000376Metagenome / Metatranscriptome1216Y
F002622Metagenome / Metatranscriptome542Y
F033808Metagenome / Metatranscriptome176Y

Sequences

Protein IDFamilyRBSSequence
Ga0214921_1002079016F033808AGGMEMFLICGMAIGFLVGYPLGLFIDKLDKDIKNDRG
Ga0214921_100207905F002622GGAGMNEEEHDARIAYYLEIGAISFEGVDESGEIIYSISDSAKELAPELWQSHIEYVDKSLIELYEQGLVEIEYNEKLEATIHITPEGQKIAKEKGLIEMDLNPDIPND
Ga0214921_100207907F000376AGGAMSTYQEKAKECKCCGKHVPLPTVLKEYNGTVLCPTTFSNVIEYKRIWKLSGHRPMGNIRKHFSEYVQQIVEETIDKNEDGTL
Ga0214921_100207909F000369GAGLSDHFDRMNKVVEELLKGSTPTQIATITGIQRKEVVELIDDWKDVVHNDSNIRDRAREAISGADQHYAMLIKEAWKTVEDADQSGQLGIKSGALKLIADIETKRIAMLQSIGVLENNEIASQIAETERKQDILVKILKETTSTCPKCKMEVAKRLSQITGIIESVPVEEADVV
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.